PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g00420.1
Common NameLR48_Vigan10g002600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 242aa    MW: 26139.2 Da    PI: 6.8634
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g00420.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.2e-08101130332
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmg 32 
                      +WT+eE+  ++ + ++lG+g+W+ I+r   
   Vang02g00420.1 101 PWTEEEHRTFLVGLEKLGKGDWRGISRNYV 130
                      8*************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.9E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
SuperFamilySSF466896.01E-796132IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-897131IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.3E-898129IPR009057Homeodomain-like
PfamPF002492.5E-6101130IPR001005SANT/Myb domain
CDDcd001675.32E-6101138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCSS FRATFVGVRL FGVQLHISNS SSLTMKKSFS MDSLPLLSSP  60
SSSFSSSRIS IDDHPEKASV GYLSDSDGLI VRPQDRKKGV PWTEEEHRTF LVGLEKLGKG  120
DWRGISRNYV GGSSNCKSDD LVSPTKSKGE IENDVTLSLL QAQETKTGEQ KDSDDCCQDE  180
AGADHEAVMW LHPQMKSSSN NSSAAIPDLE LTLSVSKDKA KTMEQTKSTP GSFFLGPISV  240
T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511106.11e-144PREDICTED: myb-like protein J
TrEMBLA0A0L9VHF91e-153A0A0L9VHF9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3TDH31e-153A0A0S3TDH3_PHAAN; Uncharacterized protein
STRINGGLYMA01G00600.16e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-34MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]